Lineage for d4ylzb_ (4ylz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780893Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)
  8. 2781041Domain d4ylzb_: 4ylz B: [276811]
    automated match to d2zhma_
    complexed with gol, so4

Details for d4ylzb_

PDB Entry: 4ylz (more details), 2.1 Å

PDB Description: crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lacto-n-neotetraose (lnnt)
PDB Compounds: (B:) Galectin-4

SCOPe Domain Sequences for d4ylzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ylzb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgngt
vvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsafq
rvdtleiqgdvtlsyvqi

SCOPe Domain Coordinates for d4ylzb_:

Click to download the PDB-style file with coordinates for d4ylzb_.
(The format of our PDB-style files is described here.)

Timeline for d4ylzb_: