SCOPe 2.07: Domain d4y9ga_: 4y9g A:

Lineage for d4y9ga_ (4y9g A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
   Uniprot P02766 31-143

8. Domain d4y9ga_: 4y9g A: [276806]
   automated match to d1ttca_
   complexed with mku

Details for d4y9ga_

PDB Entry: 4y9g, 1.89 Å

PDB Description: crystal structure of v30m mutated transthyretin in complex with 3- isomangostin

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d4y9ga_:

Sequence; same for both SEQRES and ATOM records:

>d4y9ga_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d4y9ga_:

• d4y9ga_ first appeared in SCOPe 2.05
  
• d4y9ga_ appears in SCOPe 2.06
  
• d4y9ga_ appears in the current release, SCOPe 2.08