Lineage for d1g72a_ (1g72 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066588Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 2066598Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51001] (6 PDB entries)
  8. 2066605Domain d1g72a_: 1g72 A: [27680]
    Other proteins in same PDB: d1g72b_, d1g72d_
    complexed with ca, pqq

Details for d1g72a_

PDB Entry: 1g72 (more details), 1.9 Å

PDB Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation
PDB Compounds: (A:) methanol dehydrogenase heavy subunit

SCOPe Domain Sequences for d1g72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g72a_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
tdpsaglgavgafrelqnhtqmggglmvfsl

SCOPe Domain Coordinates for d1g72a_:

Click to download the PDB-style file with coordinates for d1g72a_.
(The format of our PDB-style files is described here.)

Timeline for d1g72a_: