Lineage for d4xj7b1 (4xj7 B:1-253)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526572Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2526573Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2526589Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2526590Protein automated matches [190619] (7 species)
    not a true protein
  7. 2526609Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)
  8. 2526613Domain d4xj7b1: 4xj7 B:1-253 [276795]
    Other proteins in same PDB: d4xj7a2, d4xj7b2, d4xj7c2, d4xj7d2
    automated match to d2v4od_
    complexed with ade, adn, gol, mg, po4; mutant

Details for d4xj7b1

PDB Entry: 4xj7 (more details), 1.6 Å

PDB Description: crystal structure of e112a mutant of stationary phase survival protein (sure) from salmonella typhimurium soaked with amp
PDB Compounds: (B:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4xj7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xj7b1 c.106.1.0 (B:1-253) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdvv
sdwldsvgvgtqw

SCOPe Domain Coordinates for d4xj7b1:

Click to download the PDB-style file with coordinates for d4xj7b1.
(The format of our PDB-style files is described here.)

Timeline for d4xj7b1: