Lineage for d4xgpd1 (4xgp D:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919320Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2919321Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2919337Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2919338Protein automated matches [190619] (7 species)
    not a true protein
  7. 2919357Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)
  8. 2919369Domain d4xgpd1: 4xgp D:1-253 [276790]
    Other proteins in same PDB: d4xgpa2, d4xgpb2, d4xgpc2, d4xgpd2
    automated match to d2v4od_
    complexed with ade, edo, mg, po4; mutant

Details for d4xgpd1

PDB Entry: 4xgp (more details), 1.9 Å

PDB Description: crystal structure of e112a/h234a mutant of stationary phase survival protein (sure) from salmonella typhimurium co-crystallized and soaked with amp.
PDB Compounds: (D:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4xgpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xgpd1 c.106.1.0 (D:1-253) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdvv
sdwldsvgvgtqw

SCOPe Domain Coordinates for d4xgpd1:

Click to download the PDB-style file with coordinates for d4xgpd1.
(The format of our PDB-style files is described here.)

Timeline for d4xgpd1: