| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) ![]() some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
| Family c.106.1.0: automated matches [191430] (1 protein) not a true family |
| Protein automated matches [190619] (7 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries) |
| Domain d4xgpa1: 4xgp A:1-253 [276786] Other proteins in same PDB: d4xgpa2, d4xgpb2, d4xgpc2, d4xgpd2 automated match to d2v4od_ complexed with ade, edo, mg, po4; mutant |
PDB Entry: 4xgp (more details), 1.9 Å
SCOPe Domain Sequences for d4xgpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xgpa1 c.106.1.0 (A:1-253) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdvv
sdwldsvgvgtqw
Timeline for d4xgpa1: