SCOPe 2.05: Domain d4x42d_: 4x42 D:

Lineage for d4x42d_ (4x42 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries)

8. Domain d4x42d_: 4x42 D: [276777]
   automated match to d2h0pa_
   complexed with so4; mutant

Details for d4x42d_

PDB Entry: 4x42, 2.78 Å

PDB Description: crystal structure of den4 ed3 mutant with epitope two residues substituted from den3 ed3

PDB Compounds: (D:) Envelope protein E

SCOPe Domain Sequences for d4x42d_:

Sequence; same for both SEQRES and ATOM records:

>d4x42d_ b.1.18.0 (D:) automated matches {Dengue virus type 4 [TaxId: 408871]}
sgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
tplaentnsvtnieleppfgdsyivigvgdkalklnwfrkgs

Timeline for d4x42d_:

• d4x42d_ is new in SCOPe 2.05-stable
  
• d4x42d_ is called d4x42d1 in SCOPe 2.06
  
• d4x42d_ appears in the current release, SCOPe 2.08, called d4x42d1