SCOPe 2.08: Domain d4x42d1: 4x42 D:575-675

Lineage for d4x42d1 (4x42 D:575-675)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries)

8. Domain d4x42d1: 4x42 D:575-675 [276777]
   Other proteins in same PDB: d4x42b2, d4x42d2, d4x42f2
   automated match to d2h0pa_
   complexed with so4; mutant

Details for d4x42d1

PDB Entry: 4x42, 2.78 Å

PDB Description: crystal structure of den4 ed3 mutant with epitope two residues substituted from den3 ed3

PDB Compounds: (D:) Envelope protein E

SCOPe Domain Sequences for d4x42d1:

Sequence; same for both SEQRES and ATOM records:

>d4x42d1 b.1.18.0 (D:575-675) automated matches {Dengue virus type 4 [TaxId: 408871]}
gmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisst
plaentnsvtnieleppfgdsyivigvgdkalklnwfrkgs

Timeline for d4x42d1:

• d4x42d1 first appeared in SCOPe 2.05, called d4x42d_
  
• d4x42d1 appears in SCOPe 2.07