![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries) |
![]() | Domain d4x42b1: 4x42 B:575-673 [276774] Other proteins in same PDB: d4x42b2, d4x42d2, d4x42f2 automated match to d2h0pa_ complexed with so4; mutant |
PDB Entry: 4x42 (more details), 2.78 Å
SCOPe Domain Sequences for d4x42b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x42b1 b.1.18.0 (B:575-673) automated matches {Dengue virus type 4 [TaxId: 408871]} gmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisst plaentnsvtnieleppfgdsyivigvgdkalklnwfrk
Timeline for d4x42b1: