![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) ![]() |
![]() | Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 proteins) automatically mapped to Pfam PF02897 |
![]() | Protein Prolyl oligopeptidase, N-terminal domain [50995] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries) Uniprot P23687 |
![]() | Domain d1qfsa1: 1qfs A:1-430 [27677] Other proteins in same PDB: d1qfsa2 complexed with zpr |
PDB Entry: 1qfs (more details), 2 Å
SCOPe Domain Sequences for d1qfsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfsa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr vfrevtvkgi
Timeline for d1qfsa1: