| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
| Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) automatically mapped to Pfam PF01126 |
| Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries) Uniprot P09601 |
| Domain d4wd4b_: 4wd4 B: [276763] automated match to d1ix3a_ complexed with epe, hem |
PDB Entry: 4wd4 (more details), 2.95 Å
SCOPe Domain Sequences for d4wd4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wd4b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth
Timeline for d4wd4b_: