Lineage for d4wd4a_ (4wd4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1749972Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 1750018Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 1750019Species Human (Homo sapiens) [TaxId:9606] [48616] (24 PDB entries)
    Uniprot P09601
  8. 1750070Domain d4wd4a_: 4wd4 A: [276762]
    automated match to d1ix3a_
    complexed with epe, hem

Details for d4wd4a_

PDB Entry: 4wd4 (more details), 2.95 Å

PDB Description: crystal structure of human ho1 h25r
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d4wd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wd4a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d4wd4a_:

Click to download the PDB-style file with coordinates for d4wd4a_.
(The format of our PDB-style files is described here.)

Timeline for d4wd4a_: