Lineage for d4w9aa_ (4w9a A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773650Species Cow (Bos taurus) [TaxId:9913] [276752] (2 PDB entries)
  8. 2773652Domain d4w9aa_: 4w9a A: [276757]
    automated match to d3qk3a_

Details for d4w9aa_

PDB Entry: 4w9a (more details), 1.38 Å

PDB Description: crystal structure of gamma-b crystallin expressed in e. coli based on mrna variant 2
PDB Compounds: (A:) Gamma-crystallin B

SCOPe Domain Sequences for d4w9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9aa_ b.11.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlte
vhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmd

SCOPe Domain Coordinates for d4w9aa_:

Click to download the PDB-style file with coordinates for d4w9aa_.
(The format of our PDB-style files is described here.)

Timeline for d4w9aa_: