Lineage for d4w8ga_ (4w8g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856197Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 2856217Family c.23.2.0: automated matches [196997] (1 protein)
    not a true family
  6. 2856218Protein automated matches [196998] (2 species)
    not a true protein
  7. 2856229Species Hydra vulgaris [TaxId:6087] [276748] (1 PDB entry)
  8. 2856230Domain d4w8ga_: 4w8g A: [276749]
    automated match to d4eo7a_

Details for d4w8ga_

PDB Entry: 4w8g (more details), 1.95 Å

PDB Description: crystal structure of the tir domain of the toll-related receptor trr-2 from the lower metazoan hydra magnipapillata (crystal form i)
PDB Compounds: (A:) Toll-receptor-related 2

SCOPe Domain Sequences for d4w8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w8ga_ c.23.2.0 (A:) automated matches {Hydra vulgaris [TaxId: 6087]}
tydvnicyapedrewvintlvfkleragiktfvnirddtpgnffaenimdaiensnrtiv
vmspdffknnicdktlqiglshqiipilyrpcevpyflnhmtyldwcdkdvrpvfwrnlf
rdirn

SCOPe Domain Coordinates for d4w8ga_:

Click to download the PDB-style file with coordinates for d4w8ga_.
(The format of our PDB-style files is described here.)

Timeline for d4w8ga_: