Lineage for d4ryuc1 (4ryu C:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919320Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2919321Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2919337Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2919338Protein automated matches [190619] (7 species)
    not a true protein
  7. 2919352Species Salmonella enterica [TaxId:1412588] [276743] (1 PDB entry)
  8. 2919355Domain d4ryuc1: 4ryu C:1-253 [276747]
    Other proteins in same PDB: d4ryua2, d4ryub2, d4ryuc2, d4ryud2
    automated match to d2v4od_
    complexed with gol, mg, mpd, po4; mutant

Details for d4ryuc1

PDB Entry: 4ryu (more details), 2.04 Å

PDB Description: crystal structure of c2 form of e112a mutant of stationary phase survival protein (sure) from salmonella typhimurium
PDB Compounds: (C:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4ryuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ryuc1 c.106.1.0 (C:1-253) automated matches {Salmonella enterica [TaxId: 1412588]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdvv
sdwldsvgvgtqw

SCOPe Domain Coordinates for d4ryuc1:

Click to download the PDB-style file with coordinates for d4ryuc1.
(The format of our PDB-style files is described here.)

Timeline for d4ryuc1: