Lineage for d4ryta_ (4ryt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883008Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 1883009Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 1883025Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 1883026Protein automated matches [190619] (6 species)
    not a true protein
  7. 1883047Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)
  8. 1883066Domain d4ryta_: 4ryt A: [276742]
    automated match to d2v4od_
    complexed with edo, mg, po4; mutant

Details for d4ryta_

PDB Entry: 4ryt (more details), 2.09 Å

PDB Description: crystal structure of f222 form of e112a mutant of stationary phase survival protein (sure) from salmonella typhimurium
PDB Compounds: (A:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4ryta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ryta_ c.106.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
vsdwldsvgvgtqw

SCOPe Domain Coordinates for d4ryta_:

Click to download the PDB-style file with coordinates for d4ryta_.
(The format of our PDB-style files is described here.)

Timeline for d4ryta_:

  • d4ryta_ appears in periodic updates to SCOPe 2.05 starting on 2015-09-21
  • d4ryta_ is called d4ryta1 in SCOPe 2.06
  • d4ryta_ appears in the current release, SCOPe 2.07, called d4ryta1