SCOPe 2.08: Domain d4ryta1: 4ryt A:1-253

Lineage for d4ryta1 (4ryt A:1-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)

8. Domain d4ryta1: 4ryt A:1-253 [276742]
   Other proteins in same PDB: d4ryta2
   automated match to d2v4od_
   complexed with edo, mg, po4; mutant

Details for d4ryta1

PDB Entry: 4ryt, 2.09 Å

PDB Description: crystal structure of f222 form of e112a mutant of stationary phase survival protein (sure) from salmonella typhimurium

PDB Compounds: (A:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4ryta1:

Sequence; same for both SEQRES and ATOM records:

>d4ryta1 c.106.1.0 (A:1-253) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdvv
sdwldsvgvgtqw

Timeline for d4ryta1:

• d4ryta1 first appeared in SCOPe 2.05, called d4ryta_
  
• d4ryta1 appears in SCOPe 2.07