![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) ![]() |
![]() | Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein) |
![]() | Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries) |
![]() | Domain d1e8ma1: 1e8m A:1-430 [27674] Other proteins in same PDB: d1e8ma2 complexed with bzo, gly, gol, pro; mutant |
PDB Entry: 1e8m (more details), 1.5 Å
SCOP Domain Sequences for d1e8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8ma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr vfrevtvkgi
Timeline for d1e8ma1: