Lineage for d4refa_ (4ref A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008847Protein Orphan nuclear receptor NR4A1 [158811] (1 species)
  7. 2008848Species Human (Homo sapiens) [TaxId:9606] [158812] (15 PDB entries)
    Uniprot P22736 363-595
  8. 2008859Domain d4refa_: 4ref A: [276738]
    automated match to d3v3qa1
    complexed with 3n0, gol

Details for d4refa_

PDB Entry: 4ref (more details), 2.1 Å

PDB Description: crystal structure of tr3 lbd_l449w in complex with molecule 2
PDB Compounds: (A:) Nuclear receptor subfamily 4 group A member 1

SCOPe Domain Sequences for d4refa_:

Sequence, based on SEQRES records: (download)

>d4refa_ a.123.1.1 (A:) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
anlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwa
ekipgfaelspadqdlllesaflelfiwrlayrskpgegklifcsglvlhrlqcargfgd
widsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaa
vagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf

Sequence, based on observed residues (ATOM records): (download)

>d4refa_ a.123.1.1 (A:) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
anlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwa
ekipgfaelspadqdlllesaflelfiwrlayrskpgegklifcsglvlhrlqcargfgd
widsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaa
vagclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf

SCOPe Domain Coordinates for d4refa_:

Click to download the PDB-style file with coordinates for d4refa_.
(The format of our PDB-style files is described here.)

Timeline for d4refa_: