Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.9: TFIIH domain [110272] (2 proteins) |
Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110274] (5 PDB entries) Uniprot P32780 1-108 |
Domain d2rvbb_: 2rvb B: [276737] automated match to d2rukb_ protein/DNA complex |
PDB Entry: 2rvb (more details)
SCOPe Domain Sequences for d2rvbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rvbb_ b.55.1.9 (B:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
Timeline for d2rvbb_: