Lineage for d2rvbb_ (2rvb B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071513Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 2071528Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)
  7. 2071529Species Human (Homo sapiens) [TaxId:9606] [110274] (5 PDB entries)
    Uniprot P32780 1-108
  8. 2071533Domain d2rvbb_: 2rvb B: [276737]
    automated match to d2rukb_
    protein/DNA complex

Details for d2rvbb_

PDB Entry: 2rvb (more details)

PDB Description: solution structure of the complex between xpc acidic domain and tfiih p62 ph domain
PDB Compounds: (B:) General transcription factor IIH subunit 1

SCOPe Domain Sequences for d2rvbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rvbb_ b.55.1.9 (B:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOPe Domain Coordinates for d2rvbb_:

Click to download the PDB-style file with coordinates for d2rvbb_.
(The format of our PDB-style files is described here.)

Timeline for d2rvbb_: