| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
| Domain d4r9hd1: 4r9h D:1-97 [276734] Other proteins in same PDB: d4r9ha2, d4r9hd2 automated match to d1k5nb_ mutant |
PDB Entry: 4r9h (more details), 1.9 Å
SCOPe Domain Sequences for d4r9hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r9hd1 b.1.1.2 (D:1-97) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengksnflncyvsgfhpcdievdllkngeriekvehsdlsfskdw
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d4r9hd1:
View in 3DDomains from other chains: (mouse over for more information) d4r9ha1, d4r9ha2, d4r9hb_, d4r9hc_ |