Lineage for d1qfma1 (1qfm A:1-430)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.7: Prolyl oligopeptidase, N-terminal domain [50993] (1 family) 
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein) Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries) 
Domain d1qfma1: 1qfm A:1-430 [27673]
Other proteins in same PDB: d1qfma2
Details for d1qfma1
PDB Entry: 1qfm (more details), 1.4 Å
PDB Description: prolyl oligopeptidase from porcine muscle
SCOP Domain Sequences for d1qfma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi
SCOP Domain Coordinates for d1qfma1:
Click to download the PDB-style file with coordinates for d1qfma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qfma1:
- d1qfma1 first appeared (with stable ids) in SCOP 1.55
- d1qfma1 appears in SCOP 1.67
- d1qfma1 appears in SCOP 1.71
- d1qfma1 appears in the current release, SCOPe 2.08
View in 3D
