SCOPe 2.08: Domain d4r9ha1: 4r9h A:1-99

Lineage for d4r9ha1 (4r9h A:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d4r9ha1: 4r9h A:1-99 [276728]
   Other proteins in same PDB: d4r9ha2, d4r9hd2
   automated match to d1k5nb_
   mutant

Details for d4r9ha1

PDB Entry: 4r9h, 1.9 Å

PDB Description: crystal structure of dimeric s33c beta-2 microglobulin mutant at 1.9 angstrom resolution

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d4r9ha1:

Sequence; same for both SEQRES and ATOM records:

>d4r9ha1 b.1.1.2 (A:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengksnflncyvsgfhpcdievdllkngeriekvehsdlsfskdw
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

Timeline for d4r9ha1:

• d4r9ha1 first appeared in SCOPe 2.05, called d4r9ha_
  
• d4r9ha1 appears in SCOPe 2.07