SCOPe 2.08: Domain d1bpoc2: 1bpo C:1-330

Lineage for d1bpoc2 (1bpo C:1-330)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family)

5. Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)

6. Protein Clathrin heavy-chain terminal domain [50991] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries)

8. Domain d1bpoc2: 1bpo C:1-330 [27672]
   Other proteins in same PDB: d1bpoa1, d1bpob1, d1bpoc1

Details for d1bpoc2

PDB Entry: 1bpo, 2.6 Å

PDB Description: clathrin heavy-chain terminal domain and linker

PDB Compounds: (C:) protein (clathrin)

SCOPe Domain Sequences for d1bpoc2:

Sequence; same for both SEQRES and ATOM records:

>d1bpoc2 b.69.6.1 (C:1-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
etifvtapheatagiigvnrkgqvlsvcve

Timeline for d1bpoc2:

• d1bpoc2 first appeared (with stable ids) in SCOP 1.55
  
• d1bpoc2 appears in SCOPe 2.07