![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein (Apo)ferritin [47246] (8 species) |
![]() | Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries) |
![]() | Domain d4oyna_: 4oyn A: [276718] automated match to d4ml5a_ complexed with bcn, cl, fe, mg, trs |
PDB Entry: 4oyn (more details), 1.43 Å
SCOPe Domain Sequences for d4oyna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oyna_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]} tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
Timeline for d4oyna_: