SCOPe 2.08: Domain d5da4b1: 5da4 B:9-125

Lineage for d5da4b1 (5da4 B:9-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5da4b1: 5da4 B:9-125 [276712]
   Other proteins in same PDB: d5da4a2, d5da4b2, d5da4c2
   automated match to d4w81a_

Details for d5da4b1

PDB Entry: 5da4, 2.4 Å

PDB Description: structure of a nanobody recognizing the fumarate transporter slc26dg

PDB Compounds: (B:) Nanobody recognizing the membrane protein SLC26Dg

SCOPe Domain Sequences for d5da4b1:

Sequence; same for both SEQRES and ATOM records:

>d5da4b1 b.1.1.1 (B:9-125) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksynadsvk
grftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvtvss

Timeline for d5da4b1:

• d5da4b1 first appeared in SCOPe 2.05, called d5da4b_
  
• d5da4b1 was called d5da4b_ in SCOPe 2.07