Lineage for d5da4c1 (5da4 C:9-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744030Domain d5da4c1: 5da4 C:9-125 [276711]
    Other proteins in same PDB: d5da4a2, d5da4b2, d5da4c2
    automated match to d4w81a_

Details for d5da4c1

PDB Entry: 5da4 (more details), 2.4 Å

PDB Description: structure of a nanobody recognizing the fumarate transporter slc26dg
PDB Compounds: (C:) Nanobody recognizing the membrane protein SLC26Dg

SCOPe Domain Sequences for d5da4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5da4c1 b.1.1.1 (C:9-125) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksynadsvk
grftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvtvss

SCOPe Domain Coordinates for d5da4c1:

Click to download the PDB-style file with coordinates for d5da4c1.
(The format of our PDB-style files is described here.)

Timeline for d5da4c1: