Lineage for d5da4a_ (5da4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356158Domain d5da4a_: 5da4 A: [276710]
    automated match to d4w81a_

Details for d5da4a_

PDB Entry: 5da4 (more details), 2.4 Å

PDB Description: structure of a nanobody recognizing the fumarate transporter slc26dg
PDB Compounds: (A:) Nanobody recognizing the membrane protein SLC26Dg

SCOPe Domain Sequences for d5da4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5da4a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
sqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksy
nadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvt
vss

SCOPe Domain Coordinates for d5da4a_:

Click to download the PDB-style file with coordinates for d5da4a_.
(The format of our PDB-style files is described here.)

Timeline for d5da4a_: