SCOPe 2.08: Domain d5dd4a1: 5dd4 A:5-149

Lineage for d5dd4a1 (5dd4 A:5-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins)
   accosiated with the C-terminal "winged helix" domain (46785)

6. Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (3 PDB entries)
   Uniprot Q8AAV8 3-149

8. Domain d5dd4a1: 5dd4 A:5-149 [276706]
   Other proteins in same PDB: d5dd4a2
   automated match to d2fb1a2
   complexed with act, edo

Details for d5dd4a1

PDB Entry: 5dd4, 2.56 Å

PDB Description: apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi

PDB Compounds: (A:) transcriptional regulator AraR

SCOPe Domain Sequences for d5dd4a1:

Sequence; same for both SEQRES and ATOM records:

>d5dd4a1 d.113.1.6 (A:5-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
yssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakrvl
aeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvninel
palifdhpemvdkaremmkqkasve

Timeline for d5dd4a1:

• d5dd4a1 first appeared in SCOPe 2.05
  
• d5dd4a1 appears in SCOPe 2.07