SCOPe 2.08: Domain d5dd8a_: 5dd8 A:

Lineage for d5dd8a_ (5dd8 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (6 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [187697] (2 PDB entries)

8. Domain d5dd8a_: 5dd8 A: [276705]
   automated match to d2fbka1
   complexed with cl; mutant

Details for d5dd8a_

PDB Entry: 5dd8, 2.05 Å

PDB Description: the crystal structure of hucr mutant (hucr-e48q) from deinococcus radiodurans

PDB Compounds: (A:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d5dd8a_:

Sequence, based on SEQRES records:

>d5dd8a_ a.4.5.28 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
dtaallerirsdwarlnhgqgpdsdgltpsagpmltllllqrlhaalgreiertyaasgl
naagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierrederdrrs
asirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleq

Sequence, based on observed residues (ATOM records):

>d5dd8a_ a.4.5.28 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
dtaallerirsdwarlnhgpsagpmltllllqrlhaalgreiertyaasglnaagwdlll
tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl
lpahlattqrvlaplsaqeqrtleelagrmlagleq

Timeline for d5dd8a_:

• d5dd8a_ first appeared in SCOPe 2.05
  
• d5dd8a_ appears in SCOPe 2.07