![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein automated matches [190294] (6 species) not a true protein |
![]() | Species Deinococcus radiodurans [TaxId:1299] [187697] (2 PDB entries) |
![]() | Domain d5dd8b_: 5dd8 B: [276704] automated match to d2fbka1 complexed with cl; mutant |
PDB Entry: 5dd8 (more details), 2.05 Å
SCOPe Domain Sequences for d5dd8b_:
Sequence, based on SEQRES records: (download)
>d5dd8b_ a.4.5.28 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]} dtaallerirsdwarlnhgqgpdsdgltpsagpmltllllqrlhaalgreiertyaasgl naagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierrederdrrs asirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleq
>d5dd8b_ a.4.5.28 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]} dtaallerirsdwarlnhgpsagpmltllllqrlhaalgreiertyaasglnaagwdlll tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl lpahlattqrvlaplsaqeqrtleelagrmlagleq
Timeline for d5dd8b_: