Lineage for d4d4xa_ (4d4x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988318Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1988486Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 1988540Protein automated matches [190363] (5 species)
    not a true protein
  7. 1988541Species Achromobacter xylosoxidans [TaxId:85698] [189489] (28 PDB entries)
  8. 1988567Domain d4d4xa_: 4d4x A: [276697]
    automated match to d4cdaa_
    complexed with hec, no

Details for d4d4xa_

PDB Entry: 4d4x (more details), 1.3 Å

PDB Description: nitrosyl complex of the d121i variant of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d4d4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d4xa_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
iayrkk

SCOPe Domain Coordinates for d4d4xa_:

Click to download the PDB-style file with coordinates for d4d4xa_.
(The format of our PDB-style files is described here.)

Timeline for d4d4xa_: