Lineage for d1c9ib2 (1c9i B:4-330)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62854Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 62921Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 62922Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (1 protein)
  6. 62923Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 62924Species Rat (Rattus norvegicus) [TaxId:10116] [50992] (3 PDB entries)
  8. 62928Domain d1c9ib2: 1c9i B:4-330 [27669]
    Other proteins in same PDB: d1c9ia1, d1c9ib1

Details for d1c9ib2

PDB Entry: 1c9i (more details), 2.9 Å

PDB Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin

SCOP Domain Sequences for d1c9ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ib2 b.69.6.1 (B:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus)}
ilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpir
rpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvt
dnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamql
ysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpf
pkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgeti
fvtapheatagiigvnrkgqvlsvcve

SCOP Domain Coordinates for d1c9ib2:

Click to download the PDB-style file with coordinates for d1c9ib2.
(The format of our PDB-style files is described here.)

Timeline for d1c9ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c9ib1