SCOPe 2.08: Domain d5cqaa1: 5cqa A:1858-1970

Lineage for d5cqaa1 (5cqa A:1858-1970)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5cqaa1: 5cqa A:1858-1970 [276689]
   Other proteins in same PDB: d5cqaa2
   automated match to d4rvra_
   complexed with 2ly, edo

Details for d5cqaa1

PDB Entry: 5cqa, 2.13 Å

PDB Description: crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2b (baz2b) in complex with n-methyl-2,3- dihydrothieno[3,4-b][1,4]dioxine-5-carboxamide (sgc - diamond i04-1 fragment screening)

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5cqaa1:

Sequence; same for both SEQRES and ATOM records:

>d5cqaa1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

Timeline for d5cqaa1:

• d5cqaa1 first appeared in SCOPe 2.05, called d5cqaa_
  
• d5cqaa1 appears in SCOPe 2.07