Lineage for d5cq7a1 (5cq7 A:1858-1970)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (7 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (372 PDB entries)
  8. 1992794Domain d5cq7a1: 5cq7 A:1858-1970 [276688]
    Other proteins in same PDB: d5cq7a2
    automated match to d4rvra_
    complexed with 53g, edo

Details for d5cq7a1

PDB Entry: 5cq7 (more details), 1.86 Å

PDB Description: crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2b (baz2b) in complex with n,n- dimethylquinoxaline-6-carboxamide (sgc - diamond i04-1 fragment screening)
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5cq7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cq7a1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d5cq7a1:

Click to download the PDB-style file with coordinates for d5cq7a1.
(The format of our PDB-style files is described here.)

Timeline for d5cq7a1:

  • d5cq7a1 first appeared in SCOPe 2.05, called d5cq7a_

View in 3D
Domains from same chain:
(mouse over for more information)
d5cq7a2