SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5cq7a1 (5cq7 A:1858-1970)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (8 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (589 PDB entries)
  8. 1992794Domain d5cq7a1: 5cq7 A:1858-1970 [276688]
    Other proteins in same PDB: d5cq7a2
    automated match to d4rvra_
    complexed with 53g, edo

Details for d5cq7a1

PDB Entry: 5cq7 (more details), 1.86 Å

PDB Description: crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2b (baz2b) in complex with n,n- dimethylquinoxaline-6-carboxamide (sgc - diamond i04-1 fragment screening)
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5cq7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cq7a1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d5cq7a1:

Click to download the PDB-style file with coordinates for d5cq7a1.
(The format of our PDB-style files is described here.)

Timeline for d5cq7a1:

  • d5cq7a1 first appeared in SCOPe 2.05, called d5cq7a_

View in 3D
Domains from same chain:
(mouse over for more information)
d5cq7a2