SCOPe 2.05: Domain d5cq5a_: 5cq5 A:

Lineage for d5cq5a_ (5cq5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d5cq5a_: 5cq5 A: [276685]
   automated match to d4rvra_
   complexed with 53e, edo

Details for d5cq5a_

PDB Entry: 5cq5, 1.96 Å

PDB Description: crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2b (baz2b) in complex with 2,3- ethylenedioxybenzoic acid (sgc - diamond i04-1 fragment screening)

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5cq5a_:

Sequence; same for both SEQRES and ATOM records:

>d5cq5a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf

Timeline for d5cq5a_:

• d5cq5a_ is new in SCOPe 2.05-stable
  
• d5cq5a_ is called d5cq5a1 in SCOPe 2.06
  
• d5cq5a_ appears in the current release, SCOPe 2.08, called d5cq5a1