Lineage for d5cnkb_ (5cnk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144140Species Human (Homo sapiens) [TaxId:9606] [189363] (10 PDB entries)
  8. 2144155Domain d5cnkb_: 5cnk B: [276680]
    Other proteins in same PDB: d5cnkc2
    automated match to d3sm9a_
    complexed with ggl, iod

Details for d5cnkb_

PDB Entry: 5cnk (more details), 3.15 Å

PDB Description: mglur3 with glutamate
PDB Compounds: (B:) Metabotropic glutamate receptor 3

SCOPe Domain Sequences for d5cnkb_:

Sequence, based on SEQRES records: (download)

>d5cnkb_ c.93.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyllpgv
klgvhildtcsrdtyaleqslefvrasltkvdeaeymcpdgsyaiqeniplliagviggs
yssvsiqvanllrlfqipqisyastsaklsdksrydyfartvppdfyqakamaeilrffn
wtyvstvasegdygetgieafeqearlrnisiataekvgrsnirksydsvirellqkpna
rvvvlfmrsddsreliaaasranasftwvasdgwgaqesiikgsehvaygaitlelasqp
vrqfdryfqslnpynnhrnpwfrdfweqkfqcslqnkrnhrrvcdkhlaidssnyeqesk
imfvvnavyamahalhkmqrtlcpnttklcdamkildgkklykdyllkinftapfnpnkd
adsivkfdtfgdgmgrynvfnfqnvggkysylkvghwaetlsldvnsihw

Sequence, based on observed residues (ATOM records): (download)

>d5cnkb_ c.93.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyllpgv
klgvhildtcsrdtyaleqslefvrasllliagviggsyssvsiqvanllrlfqipqisy
astsaklsdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafe
qearlrnisiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaasra
nasftwvasdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwf
rdfweqkfqcslrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttkl
cdamkildgkklykdyllkinftapfnpadsivkfdtfgdgmgrynvfnfqnvggkysyl
kvghwaetlsldvnsihw

SCOPe Domain Coordinates for d5cnkb_:

Click to download the PDB-style file with coordinates for d5cnkb_.
(The format of our PDB-style files is described here.)

Timeline for d5cnkb_: