Lineage for d1c9ia2 (1c9i A:3-330)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803419Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 1803420Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. 1803421Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 1803422Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries)
  8. 1803431Domain d1c9ia2: 1c9i A:3-330 [27668]
    Other proteins in same PDB: d1c9ia1, d1c9ib1
    complex with clathrin-box peptide of B-adaptin 3

Details for d1c9ia2

PDB Entry: 1c9i (more details), 2.9 Å

PDB Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin
PDB Compounds: (A:) clathrin

SCOPe Domain Sequences for d1c9ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ia2 b.69.6.1 (A:3-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d1c9ia2:

Click to download the PDB-style file with coordinates for d1c9ia2.
(The format of our PDB-style files is described here.)

Timeline for d1c9ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c9ia1