Lineage for d1c9ia2 (1c9i A:3-330)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469053Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 469184Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 469185Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (1 protein)
  6. 469186Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 469187Species Rat (Rattus norvegicus) [TaxId:10116] [50992] (4 PDB entries)
  8. 469192Domain d1c9ia2: 1c9i A:3-330 [27668]
    Other proteins in same PDB: d1c9ia1, d1c9ib1

Details for d1c9ia2

PDB Entry: 1c9i (more details), 2.9 Å

PDB Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin

SCOP Domain Sequences for d1c9ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ia2 b.69.6.1 (A:3-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus)}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

SCOP Domain Coordinates for d1c9ia2:

Click to download the PDB-style file with coordinates for d1c9ia2.
(The format of our PDB-style files is described here.)

Timeline for d1c9ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c9ia1