Lineage for d5cnjb_ (5cnj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144140Species Human (Homo sapiens) [TaxId:9606] [189363] (10 PDB entries)
  8. 2144150Domain d5cnjb_: 5cnj B: [276677]
    automated match to d3sm9a_
    complexed with 52q, nag

Details for d5cnjb_

PDB Entry: 5cnj (more details), 2.65 Å

PDB Description: mglur2 with glutamate analog
PDB Compounds: (B:) Metabotropic glutamate receptor 2

SCOPe Domain Sequences for d5cnjb_:

Sequence, based on SEQRES records: (download)

>d5cnjb_ c.93.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkvltlegdlvlgglfpvhqkggpaedcgpvnehrgiqrleamlfaldrinrdphllpgv
rlgahildscskdthaleqaldfvraslsrgadgsrhicpdgsyathgdaptaitgvigg
sysdvsiqvanllrlfqipqisyastsaklsdksrydyfartvppdffqakamaeilrff
nwtyvstvasegdygetgieafeleararnisvatsekvgramsraafegvvrallqkps
arvavlftrsedarellaasqrlnasftwvasdgwgalesvvagsegaaegaitielasy
pisdfasyfqsldpwnnsrnpwfrefweqrfrcsfrqrdcaahslravpfeqeskimfvv
navyamahalhnmhralcpnttrlcdamrpvngrrlykdfvlnvkfdapfrpadthnevr
fdrfgdgigryniftylragsgryryqkvgywaegltldtslipwa

Sequence, based on observed residues (ATOM records): (download)

>d5cnjb_ c.93.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkvltlegdlvlgglfpvhqkggpaedcgpvnehrgiqrleamlfaldrinrdphllpgv
rlgahildscskdthaleqaldfvraslsptaitgviggsysdvsiqvanllrlfqipqi
syastsaklsdksrydyfartvppdffqakamaeilrffnwtyvstvasegdygetgiea
feleararnisvatsekvgramsraafegvvrallqkpsarvavlftrsedarellaasq
rlnasftwvasdgwgalesvvagsegaaegaitielasypisdfasyfqsldpwnnsrnp
wfrefweqrfrcsfrqrdcaahslravpfeqeskimfvvnavyamahalhnmhralcpnt
trlcdamrpvngrrlykdfvlnvkfdapfrpadthnevrfdrfgdgigryniftylrags
gryryqkvgywaegltldtslipwa

SCOPe Domain Coordinates for d5cnjb_:

Click to download the PDB-style file with coordinates for d5cnjb_.
(The format of our PDB-style files is described here.)

Timeline for d5cnjb_: