Lineage for d5clld_ (5cll D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (21 PDB entries)
  8. 1799443Domain d5clld_: 5cll D: [276672]
    Other proteins in same PDB: d5clla_, d5cllc_
    automated match to d4hb2b_
    complexed with bef, gdp, mg

Details for d5clld_

PDB Entry: 5cll (more details), 2.45 Å

PDB Description: truncated ran wild type in complex with gdp-bef and ranbd1
PDB Compounds: (D:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d5clld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5clld_ b.55.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gphfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsg
kirllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktp
eeaalfkckfeeaqsilka

SCOPe Domain Coordinates for d5clld_:

Click to download the PDB-style file with coordinates for d5clld_.
(The format of our PDB-style files is described here.)

Timeline for d5clld_: