SCOP 1.67: Domain d1c9lb2: 1c9l B:3-330

Lineage for d1c9lb2 (1c9l B:3-330)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family)

5. Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (1 protein)

6. Protein Clathrin heavy-chain terminal domain [50991] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50992] (4 PDB entries)

8. Domain d1c9lb2: 1c9l B:3-330 [27667]
   Other proteins in same PDB: d1c9la1, d1c9lb1
   complex with clathrin-box peptide of B-adaptin 3

Details for d1c9lb2

PDB Entry: 1c9l, 2.9 Å

PDB Description: peptide-in-groove interactions link target proteins to the b-propeller of clathrin

SCOP Domain Sequences for d1c9lb2:

Sequence; same for both SEQRES and ATOM records:

>d1c9lb2 b.69.6.1 (B:3-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus)}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

Timeline for d1c9lb2:

• d1c9lb2 first appeared (with stable ids) in SCOP 1.55
  
• d1c9lb2 appears in SCOP 1.65
  
• d1c9lb2 appears in SCOP 1.69
  
• d1c9lb2 appears in the current release, SCOPe 2.08