Lineage for d5cj2a_ (5cj2 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475783Protein Ran [52609] (2 species)
  7. 2475804Species Human (Homo sapiens) [TaxId:9606] [52611] (87 PDB entries)
  8. 2475826Domain d5cj2a_: 5cj2 A: [276659]
    automated match to d2mmca_
    complexed with gdp, mg, po4; mutant

Details for d5cj2a_

PDB Entry: 5cj2 (more details), 1.75 Å

PDB Description: ran gdp y39a mutant triclinic crystal form
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5cj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cj2a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdleva

SCOPe Domain Coordinates for d5cj2a_:

Click to download the PDB-style file with coordinates for d5cj2a_.
(The format of our PDB-style files is described here.)

Timeline for d5cj2a_: