SCOPe 2.07: Domain d5abjc_: 5abj C:

Lineage for d5abjc_ (5abj C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (25 species)
   not a true protein

7. Species Coxsackievirus a16 [TaxId:31704] [276274] (7 PDB entries)

8. Domain d5abjc_: 5abj C: [276645]
   Other proteins in same PDB: d5abja_, d5abjb_
   automated match to d5c4wc_
   complexed with cl, na, ym2

Details for d5abjc_

PDB Entry: 5abj, 2.75 Å

PDB Description: structure of coxsackievirus a16 in complex with gpp3

PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d5abjc_:

Sequence; same for both SEQRES and ATOM records:

>d5abjc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
iq

Timeline for d5abjc_:

• d5abjc_ first appeared in SCOPe 2.05
  
• d5abjc_ appears in SCOPe 2.06
  
• d5abjc_ appears in the current release, SCOPe 2.08