Lineage for d5abjc_ (5abj C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086889Protein automated matches [190854] (15 species)
    not a true protein
  7. 2086892Species Coxsackievirus a16 [TaxId:31704] [276274] (3 PDB entries)
  8. 2086895Domain d5abjc_: 5abj C: [276645]
    Other proteins in same PDB: d5abja_, d5abjb_
    automated match to d5c4wc_
    complexed with cl, na, ym2

Details for d5abjc_

PDB Entry: 5abj (more details), 2.75 Å

PDB Description: structure of coxsackievirus a16 in complex with gpp3
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d5abjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abjc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
iq

SCOPe Domain Coordinates for d5abjc_:

Click to download the PDB-style file with coordinates for d5abjc_.
(The format of our PDB-style files is described here.)

Timeline for d5abjc_: