Lineage for d5abjb_ (5abj B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087278Species Coxsackievirus a16 [TaxId:31704] [276271] (3 PDB entries)
  8. 2087283Domain d5abjb_: 5abj B: [276642]
    Other proteins in same PDB: d5abjc_
    automated match to d4jgyb_
    complexed with cl, na, ym2

Details for d5abjb_

PDB Entry: 5abj (more details), 2.75 Å

PDB Description: structure of coxsackievirus a16 in complex with gpp3
PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d5abjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abjb_ b.121.4.0 (B:) automated matches {Coxsackievirus a16 [TaxId: 31704]}
sdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfftldtk
swakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallvavlpe
yvlgtiaggtgnenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinlrtnn
catiivpymntvpfdsalnhcnfgllvipvvpldfnagatseipitvtiapmcaefaglr
qavkq

SCOPe Domain Coordinates for d5abjb_:

Click to download the PDB-style file with coordinates for d5abjb_.
(The format of our PDB-style files is described here.)

Timeline for d5abjb_: