Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Coxsackievirus a16 [TaxId:31704] [276271] (7 PDB entries) |
Domain d5abjb_: 5abj B: [276642] Other proteins in same PDB: d5abjc_ automated match to d4jgyb_ complexed with cl, na, ym2 |
PDB Entry: 5abj (more details), 2.75 Å
SCOPe Domain Sequences for d5abjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5abjb_ b.121.4.0 (B:) automated matches {Coxsackievirus a16 [TaxId: 31704]} sdrvaqltignstittqeaaniviaygewpeycpdtdatavdkptrpdvsvnrfftldtk swakdskgwywkfpdvltevgvfgqnaqfhylyrsgfcvhvqcnaskfhqgallvavlpe yvlgtiaggtgnenshppyattqpgqvgavlthpyvldagiplsqltvcphqwinlrtnn catiivpymntvpfdsalnhcnfgllvipvvpldfnagatseipitvtiapmcaefaglr qavkq
Timeline for d5abjb_: