Lineage for d1a12b_ (1a12 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066236Superfamily b.69.5: RCC1/BLIP-II [50985] (2 families) (S)
    two families are clearly related but differ by the number of strands per blade
  5. 2066237Family b.69.5.1: Regulator of chromosome condensation RCC1 [50986] (1 protein)
  6. 2066238Protein Regulator of chromosome condensation RCC1 [50987] (1 species)
  7. 2066239Species Human (Homo sapiens) [TaxId:9606] [50988] (2 PDB entries)
  8. 2066241Domain d1a12b_: 1a12 B: [27664]

Details for d1a12b_

PDB Entry: 1a12 (more details), 1.7 Å

PDB Description: regulator of chromosome condensation (rcc1) of human
PDB Compounds: (B:) regulator of chromosome condensation 1

SCOPe Domain Sequences for d1a12b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a12b_ b.69.5.1 (B:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]}
kkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtv
clsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrv
flwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcge
qgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaishegh
vygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgr
aeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtg
qdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs

SCOPe Domain Coordinates for d1a12b_:

Click to download the PDB-style file with coordinates for d1a12b_.
(The format of our PDB-style files is described here.)

Timeline for d1a12b_: