Lineage for d4zs6l2 (4zs6 L:106-210)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762674Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
  8. 1762813Domain d4zs6l2: 4zs6 L:106-210 [276629]
    Other proteins in same PDB: d4zs6d1, d4zs6l1
    automated match to d1dn0a2
    complexed with nag

Details for d4zs6l2

PDB Entry: 4zs6 (more details), 3.17 Å

PDB Description: receptor binding domain and fab complex
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4zs6l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zs6l2 b.1.1.2 (L:106-210) automated matches {Homo sapiens [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4zs6l2:

Click to download the PDB-style file with coordinates for d4zs6l2.
(The format of our PDB-style files is described here.)

Timeline for d4zs6l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zs6l1