SCOPe 2.05: Domain d4zs6l2: 4zs6 L:106-210

Lineage for d4zs6l2 (4zs6 L:106-210)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4zs6l2: 4zs6 L:106-210 [276629]
   Other proteins in same PDB: d4zs6d1, d4zs6l1
   automated match to d1dn0a2
   complexed with nag

Details for d4zs6l2

PDB Entry: 4zs6, 3.17 Å

PDB Description: receptor binding domain and fab complex

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4zs6l2:

Sequence; same for both SEQRES and ATOM records:

>d4zs6l2 b.1.1.2 (L:106-210) automated matches {Homo sapiens [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4zs6l2:

• d4zs6l2 is new in SCOPe 2.05-stable
  
• d4zs6l2 appears in SCOPe 2.06
  
• d4zs6l2 appears in the current release, SCOPe 2.08