Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4zs6d1: 4zs6 D:1-105 [276626] Other proteins in same PDB: d4zs6c_, d4zs6d2, d4zs6h_, d4zs6l2 automated match to d1dn0a1 complexed with nag |
PDB Entry: 4zs6 (more details), 3.17 Å
SCOPe Domain Sequences for d4zs6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zs6d1 b.1.1.0 (D:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} airmtqspsflsasvgdrvtitcrasqdinsflawyqqrpgkapklliygasnletgvps rfsgggsgtdftltisslqpediatyycqqydklptfgqgtrlei
Timeline for d4zs6d1:
View in 3D Domains from other chains: (mouse over for more information) d4zs6c_, d4zs6h_, d4zs6l1, d4zs6l2 |